AiPD: Autoinhibited Protein Database

Q7Z2X4

Gene name	PID1 (NYGGF4, PCLI1, HMFN2073)
Protein name	PTB-containing, cubilin and LRP1-interacting protein
Names	P-CLI1, Phosphotyrosine interaction domain-containing protein 1, Protein NYGGF4
Species	Homo sapiens (Human)
KEGG Pathway	hsa:55022
EC number
Protein Class

Descriptions

The autoinhibited protein was predicted that may have potential autoinhibitory elements via cis-regPred.

Autoinhibitory domains (AIDs)

195-250 (Predicted disordered autoinhibitory region) PR

Target domain
Relief mechanism
Assay	cis-regPred

AID

195-250 (Predicted disordered autoinhibitory region)

Target domain

Relief mechanism

Assay

cis-regPred

Accessory elements

No accessory elements

References

Yeon JH et al. (2016) "Systems-wide Identification of cis-Regulatory Elements in Proteins", Cell Systems, 2, 89-100

Autoinhibited structure

Activated structure

1 structures for Q7Z2X4

Entry ID	Method	Resolution	Chain	Position	Source
AF-Q7Z2X4-F1	Predicted				AlphaFoldDB

204 variants for Q7Z2X4

Variant ID(s)	Position	Change	Description	Diseaes Association	Provenance
rs1411748093 CA351143697	3	S>C		No	ClinGen TOPMed gnomAD
rs1411748093 CA351143698	3	S>G		No	ClinGen TOPMed gnomAD
CA351143687 rs1221120043	4	L>P		No	ClinGen TOPMed gnomAD
CA2151451 rs550803281	5	P>L		No	ClinGen 1000Genomes ExAC gnomAD
CA351143676 rs1341514037	6	L>R		No	ClinGen gnomAD
CA540261081 rs1365931046	11	C>*		No	ClinGen TOPMed gnomAD
TCGA novel	12	E>K	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs1326361959 CA351143624	14	T>A		No	ClinGen TOPMed
rs532299472 CA67375321	14	T>I		No	ClinGen 1000Genomes TOPMed gnomAD
rs747456911 CA67375320	15	A>T		No	ClinGen TOPMed gnomAD
rs1369347174 CA351143573	22	C>R		No	ClinGen gnomAD
rs764573914 CA2151450	26	K>N		No	ClinGen ExAC gnomAD
rs1234856769 CA351143527	28	I>T		No	ClinGen gnomAD
CA351143530 rs1470377879	28	I>V		No	ClinGen gnomAD
CA67375319 rs988892560	29	K>R		No	ClinGen TOPMed
rs1482785273 CA351143502	32	R>C		No	ClinGen TOPMed gnomAD
CA2151448 rs540348737	32	R>H		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151447 rs540348737	32	R>P		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
rs1195299335 CA351143488	34	L>F		No	ClinGen TOPMed
CA351143480 rs1311013549	35	I>M		No	ClinGen gnomAD
rs1301156268 CA351143479	36	M>L		No	ClinGen gnomAD
rs1031879252 CA67375318	37	I>T		No	ClinGen gnomAD
rs1375394539 CA351143450	40	A>P		No	ClinGen TOPMed
CA351143438 rs560587616	42	G>*		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151445 rs560587616	42	G>R		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
rs771130057 CA351143431	43	T>K		No	ClinGen ExAC TOPMed gnomAD
rs771130057 CA2151444	43	T>M	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA TOPMed gnomAD
VAR_030361	43	T>THFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCK	variant with duplicated exon 2 [UniProt]	No	UniProt
CA351143049 rs1559260893	46	Q>E		No	ClinGen Ensembl
CA2151421 COSM573948 rs775616491	48	M>I	lung [Cosmic]	No	ClinGen cosmic curated ExAC TOPMed gnomAD
CA351143027 rs1384849517	49	L>V		No	ClinGen gnomAD
TCGA novel	52	K>I	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs745434084 CA2151419	52	K>T		No	ClinGen ExAC TOPMed gnomAD
TCGA novel	60	K>*	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
TCGA novel	60	K>R	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs777262681 CA2151415	62	P>S		No	ClinGen ExAC gnomAD
CA67366745 rs774601480	63	L>V		No	ClinGen gnomAD
rs758850038 CA2151414	64	P>S		No	ClinGen ExAC gnomAD
CA2151413 rs372924123	65	A>V		No	ClinGen ESP ExAC TOPMed gnomAD
CA67366744 rs866131500	67	I>V		No	ClinGen TOPMed gnomAD
rs377545576 CA2151410	69	H>R		No	ClinGen ESP ExAC TOPMed gnomAD
rs554571331 CA2151411	69	H>Y		No	ClinGen 1000Genomes ExAC gnomAD
CA67366743 rs1000638719	70	E>K		No	ClinGen TOPMed
CA2151409 rs766470127	71	P>L	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA TOPMed gnomAD
rs1345703778 CA351142884	71	P>S	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen NCI-TCGA TOPMed gnomAD
CA2151407 rs750696637	73	A>V	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA gnomAD
CA67366742 rs977303703	74	I>F		No	ClinGen TOPMed gnomAD
CA351142868 rs977303703	74	I>L		No	ClinGen TOPMed gnomAD
CA2151406 rs767612357	74	I>T		No	ClinGen ExAC gnomAD
TCGA novel	76	L>V	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs1559260780 CA351142847	77	C>Y		No	ClinGen Ensembl
CA2151405 rs762863713	78	T>A		No	ClinGen ExAC gnomAD
CA2151404 rs775417884 COSM3407641	78	T>M	Variant assessed as Somatic; 0.0 impact. central_nervous_system [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated ExAC NCI-TCGA TOPMed gnomAD
CA2151402 rs759556797	80	T>I		No	ClinGen ExAC TOPMed gnomAD
rs776658269 CA2151401	81	P>L		No	ClinGen ExAC TOPMed gnomAD
CA2151398 rs772979459	83	M>T		No	ClinGen ExAC TOPMed gnomAD
rs771619447 CA2151397	86	R>G		No	ClinGen ExAC gnomAD
CA2151396 rs747732576	87	T>A		No	ClinGen ExAC TOPMed gnomAD
CA2151394 rs755288963	88	H>R		No	ClinGen ExAC gnomAD
CA2151393 rs749823807	89	S>G		No	ClinGen ExAC TOPMed gnomAD
rs780505579 CA2151392	90	G>D		No	ClinGen ExAC gnomAD
CA351142753 rs1327420683	92	K>R		No	ClinGen gnomAD
CA2151370 rs200670777	93	V>G		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151371 rs746316153	93	V>I		No	ClinGen ExAC TOPMed gnomAD
rs746316153 CA67351649	93	V>L		No	ClinGen ExAC TOPMed gnomAD
TCGA novel	94	T>A	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs1317217988 CA351142714	94	T>I		No	ClinGen gnomAD
CA351142716 rs1317217988	94	T>N		No	ClinGen gnomAD
rs1314285812 CA351142710	95	Y>S		No	ClinGen TOPMed
rs530206277 CA2151368	102	T>I		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151367 rs530206277	102	T>S		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151365 COSM1262164 rs753685149	104	M>I	oesophagus [Cosmic]	No	ClinGen cosmic curated ExAC gnomAD
CA351142656 rs1472167795	104	M>L		No	ClinGen gnomAD
CA2151366 rs774315866	104	M>T		No	ClinGen ExAC gnomAD
CA2151362 rs750328267	109	G>R		No	ClinGen ExAC gnomAD
CA2151361 rs766968657	110	C>Y		No	ClinGen ExAC gnomAD
rs867123602 CA67351647	112	E>K	Variant assessed as Somatic; impact. [NCI-TCGA]	No	ClinGen Ensembl NCI-TCGA
rs1287964613 CA351142573	116	I>T		No	ClinGen gnomAD
CA351142575 rs1230241740	116	I>V		No	ClinGen TOPMed
rs1209359881 CA351142564	117	E>D		No	ClinGen gnomAD
rs761279404 CA2151360	119	W>*		No	ClinGen ExAC gnomAD
rs369664470 CA67351646	120	K>N		No	ClinGen ESP gnomAD
rs774039165 CA2151359	122	H>Y		No	ClinGen ExAC gnomAD
rs116780832 CA2151357	123	T>M		No	ClinGen 1000Genomes ESP ExAC TOPMed gnomAD
rs138008399 CA2151358	123	T>S		No	ClinGen ESP ExAC TOPMed gnomAD
CA351142511 rs1351312818	126	R>G		No	ClinGen gnomAD
CA2151355 rs376315848	126	R>Q		No	ClinGen ESP ExAC TOPMed gnomAD
CA351142503 rs781693595	127	E>D		No	ClinGen ExAC gnomAD
CA67351645 rs746380607	127	E>K		No	ClinGen ExAC gnomAD
CA2151354 rs746380607	127	E>Q		No	ClinGen ExAC gnomAD
rs771186895 CA2151352	130	F>C		No	ClinGen ExAC gnomAD
rs1282797395 CA351142486	130	F>L	Variant assessed as Somatic; impact. [NCI-TCGA]	No	ClinGen NCI-TCGA TOPMed
COSM1733957 CA2151351 rs200100687	131	P>L	Variant assessed as Somatic; 0.0 impact. pancreas [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated 1000Genomes ExAC NCI-TCGA gnomAD
TCGA novel	132	A>T	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
TCGA novel	132	A>V	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
CA2151347 rs371656791	133	N>K		No	ClinGen ESP ExAC TOPMed gnomAD
rs752906895 COSM3407640 CA2151348	133	N>S	central_nervous_system [Cosmic]	No	ClinGen cosmic curated ExAC gnomAD
CA351142460 rs1262503709	134	A>D		No	ClinGen TOPMed
CA67351644 rs906122529	135	L>F		No	ClinGen TOPMed gnomAD
CA2151345 rs750369782	136	L>V		No	ClinGen ExAC TOPMed gnomAD
rs369349795 CA2151344	137	E>D		No	ClinGen ESP ExAC gnomAD
CA67351643 rs868310857	137	E>K	Variant assessed as Somatic; impact. [NCI-TCGA]	No	ClinGen Ensembl NCI-TCGA
rs1342150141 CA351142436	138	I>M		No	ClinGen gnomAD
CA351142442 rs1203108911	138	I>V		No	ClinGen gnomAD
rs769912855 CA351142434 COSM3723050 COSM3723049	139	R>L	upper_aerodigestive_tract [Cosmic]	No	ClinGen cosmic curated ExAC TOPMed gnomAD
rs769912855 CA351142433	139	R>P		No	ClinGen ExAC TOPMed gnomAD
rs769912855 CA2151342	139	R>Q	Variant assessed as Somatic; 4.619e-05 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA TOPMed gnomAD
CA2151343 rs756817470 COSM1406046	139	R>W	Variant assessed as Somatic; 0.0 impact. large_intestine [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated ExAC NCI-TCGA gnomAD
CA351142410 rs1378140205	143	V>I		No	ClinGen TOPMed
CA351142396 rs1350723339	144	W>C		No	ClinGen gnomAD
rs1403878830 CA351142399	144	W>L		No	ClinGen gnomAD
CA2151339 rs775155088	146	H>R		No	ClinGen ExAC TOPMed gnomAD
rs777064626 CA2151336	149	D>N	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA gnomAD
rs1574563792 CA351142352	151	K>E		No	ClinGen Ensembl
CA2151335 rs771563104	151	K>R		No	ClinGen ExAC TOPMed gnomAD
CA2151333 rs143477115	152	G>E		No	ClinGen ESP ExAC TOPMed gnomAD
CA2151334 rs747456430	152	G>W		No	ClinGen ExAC gnomAD
TCGA novel	153	E>D	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
CA2151332 rs772231276	153	E>K		No	ClinGen ExAC gnomAD
TCGA novel	153	E>V	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
CA2151331 rs374938855	154	A>S		No	ClinGen ESP ExAC TOPMed gnomAD
rs374938855 CA2151330	154	A>T		No	ClinGen ESP ExAC TOPMed gnomAD
CA2151329 rs555758096	155	T>A		No	ClinGen ExAC gnomAD
rs745661805 CA2151328	155	T>I		No	ClinGen ExAC TOPMed gnomAD
CA351142324 rs1212780806	156	V>A		No	ClinGen gnomAD
TCGA novel	156	V>L	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs757191514 CA2151326	157	H>Y		No	ClinGen ExAC gnomAD
TCGA novel rs1278434062 CA351142307	158	M>I	Variant assessed as Somatic; impact. [NCI-TCGA]	No	ClinGen gnomAD NCI-TCGA
rs143934715 CA2151325	159	D>H		No	ClinGen ESP ExAC TOPMed gnomAD
TCGA novel	160	T>A	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs763613380 CA2151324	160	T>I		No	ClinGen ExAC gnomAD
rs763613380 CA351142294	160	T>N		No	ClinGen ExAC gnomAD
rs1574563689 CA351142298	160	T>P		No	ClinGen Ensembl
rs560345468 CA67351639	163	V>L		No	ClinGen Ensembl
rs1574563668 CA351142268	164	A>V		No	ClinGen Ensembl
rs752330068 CA2151322	165	R>C		No	ClinGen ExAC TOPMed gnomAD
CA2151321 COSM3783405 COSM3783406 rs764931966	165	R>H	Variant assessed as Somatic; 0.0 impact. prostate [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated ExAC NCI-TCGA gnomAD
rs1422908127 CA351142261	166	I>V		No	ClinGen gnomAD
CA2151319 rs777061648	167	A>T	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA TOPMed gnomAD
CA916794291 rs1574563638	169	C>*		No	ClinGen Ensembl
CA2151318 rs766796821	169	C>Y		No	ClinGen ExAC gnomAD
rs1574563633 CA351142235	170	T>P		No	ClinGen Ensembl
CA351142228 COSM3938973 rs1414524157 COSM3938972	171	A>T	Variant assessed as Somatic; 0.0 impact. oesophagus [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated NCI-TCGA gnomAD
rs147550577 CA351142200	174	N>K		No	ClinGen 1000Genomes ESP ExAC TOPMed gnomAD
CA2151314 rs748239313	175	V>M		No	ClinGen ExAC TOPMed gnomAD
rs774493127 CA2151313	178	N>S		No	ClinGen ExAC TOPMed gnomAD
CA67351638 rs767190848	179	I>V		No	ClinGen Ensembl
CA2151310 rs780979505	181	A>T	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA TOPMed gnomAD
CA2151309 rs756993411	183	V>I		No	ClinGen ExAC gnomAD
rs746976329 CA2151308	185	R>G		No	ClinGen ExAC gnomAD
rs868845353 CA67351637	185	R>K		No	ClinGen gnomAD
TCGA novel	186	E>*	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs777654024 CA2151307	186	E>D	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA gnomAD
rs752250623 CA2151305	188	N>I		No	ClinGen ExAC TOPMed gnomAD
CA2151306 rs752250623	188	N>S		No	ClinGen ExAC TOPMed gnomAD
CA2151304 rs778222068	190	D>N		No	ClinGen ExAC gnomAD
rs754676523 CA2151303	191	L>R		No	ClinGen ExAC gnomAD
CA351142072 rs1435567392	194	Q>*		No	ClinGen gnomAD
rs1375061952 CA351142069	194	Q>H		No	ClinGen TOPMed
CA67351636 rs914655421	194	Q>R		No	ClinGen TOPMed
rs147401384 CA351142055	196	D>G		No	ClinGen ESP ExAC TOPMed gnomAD
CA351142057 rs1390509085	196	D>H		No	ClinGen TOPMed gnomAD
CA351142058 rs1390509085	196	D>N		No	ClinGen TOPMed gnomAD
rs147401384 CA2151302	196	D>V		No	ClinGen ESP ExAC TOPMed gnomAD
rs761090784 CA2151300	199	A>T	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA gnomAD
rs768122935 CA2151298	200	V>M		No	ClinGen ExAC gnomAD
COSM1017494 rs774492653 CA2151296	203	E>K	Variant assessed as Somatic; 0.0 impact. endometrium [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated ExAC NCI-TCGA gnomAD
rs1246511943 CA351141987	205	K>N		No	ClinGen gnomAD
CA351141979 rs1485377604	207	E>K		No	ClinGen TOPMed gnomAD
CA67351634 rs965903527	210	K>T		No	ClinGen gnomAD
CA2151295 rs768561295	212	A>G		No	ClinGen ExAC TOPMed gnomAD
CA2151294 rs763254297	213	H>N		No	ClinGen ExAC gnomAD
CA2151292 COSM442441 rs374635933	214	A>T	Variant assessed as Somatic; 0.0 impact. endometrium breast [NCI-TCGA, Cosmic]	No	ClinGen cosmic curated ESP ExAC NCI-TCGA TOPMed gnomAD
rs1367256862 CA351141929	215	M>L		No	ClinGen gnomAD
CA2151291 rs372680514	217	E>A		No	ClinGen ESP ExAC TOPMed gnomAD
rs372680514 CA2151290	217	E>G		No	ClinGen ESP ExAC TOPMed gnomAD
rs747981058 CA2151288	220	R>G		No	ClinGen ExAC TOPMed gnomAD
CA351141881 rs1456485514	221	K>R		No	ClinGen gnomAD
rs1364967420 CA351141867	223	F>S	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen NCI-TCGA gnomAD
CA2151286 rs754405826	225	S>G		No	ClinGen ExAC TOPMed gnomAD
CA67351633 rs995488872	227	K>E		No	ClinGen gnomAD
CA2151285 rs753586018	228	S>N		No	ClinGen ExAC TOPMed gnomAD
rs147151232 CA351141827	228	S>R		No	ClinGen ESP ExAC TOPMed gnomAD
rs370972921 CA2151282	229	D>E		No	ClinGen ESP ExAC TOPMed gnomAD
rs375488219 RCV001261742 CA2151283	229	D>N		No	ClinGen ClinVar ESP ExAC TOPMed dbSNP gnomAD
TCGA novel	229	D>Y	Variant assessed as Somatic; impact. [NCI-TCGA]	No	NCI-TCGA
rs142605695 CA2151280	230	G>R		No	ClinGen 1000Genomes ExAC gnomAD
rs764261003 CA2151278	231	R>Q		No	ClinGen ExAC TOPMed gnomAD
rs751961969 CA2151279	231	R>W	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen ExAC NCI-TCGA gnomAD
CA351141807 rs1175329685	232	I>N		No	ClinGen gnomAD
CA2151277 rs200236587	234	S>N		No	ClinGen 1000Genomes ExAC gnomAD
CA351141785 rs1375881382	235	N>S		No	ClinGen TOPMed
rs769987356 CA2151275	236	S>R		No	ClinGen ExAC gnomAD
CA2151272 rs544315038	239	E>*		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
rs544315038 CA2151271	239	E>K		No	ClinGen 1000Genomes ExAC TOPMed gnomAD
CA2151270 rs576959046	240	E>Q		No	ClinGen 1000Genomes ExAC gnomAD
CA351141749 rs768262534	241	V>F		No	ClinGen ExAC TOPMed gnomAD
rs768262534 CA2151269	241	V>I		No	ClinGen ExAC TOPMed gnomAD
CA67351632 COSM109436 rs147989407	242	S>P	skin [Cosmic]	No	ClinGen cosmic curated Ensembl
CA351141728 rs1257049452	244	E>A		No	ClinGen TOPMed gnomAD
CA351141700 rs1482081107	248	D>A		No	ClinGen TOPMed
CA2151266 rs558532862	248	D>N	Variant assessed as Somatic; 0.0 impact. [NCI-TCGA]	No	ClinGen 1000Genomes ExAC NCI-TCGA TOPMed gnomAD
CA2151264 rs375223051	250	G>A		No	ClinGen ESP TOPMed gnomAD
CA67351631 rs201119541	251	G>S		No	ClinGen Ensembl

No associated diseases with Q7Z2X4

2 regional properties for Q7Z2X4

Type	Name	Position	InterPro Accession
domain	PTB/PI domain	86 - 240	IPR006020
domain	PID1, PTB domain	89 - 227	IPR039114

Functions

		Description
EC Number
Subcellular Localization	Cytoplasm
PANTHER Family
PANTHER Subfamily
PANTHER Protein Class
PANTHER Pathway Category	No pathway information available

1 GO annotations of cellular component

Name	Definition
cytoplasm	The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

No GO annotations of molecular function

Name	Definition
No GO annotations for molecular function

20 GO annotations of biological process

Name	Definition
cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
cellular response to fatty acid	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fatty acid stimulus.
cellular response to interleukin-6	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-6 stimulus.
cellular response to leptin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a leptin stimulus. Leptin is a hormone manufactured primarily in the adipocytes of white adipose tissue, and the level of circulating leptin is directly proportional to the total amount of fat in the body. It plays a key role in regulating energy intake and energy expenditure, including appetite and metabolism.
cellular response to tumor necrosis factor	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a tumor necrosis factor stimulus.
energy reserve metabolic process	The chemical reactions and pathways by which a cell derives energy from stored compounds such as fats or glycogen.
mitochondrion morphogenesis	The process in which the anatomical structures of a mitochondrion are generated and organized.
negative regulation of ATP biosynthetic process	Any process that stops, prevents or reduces the frequency, rate or extent of ATP biosynthetic process.
negative regulation of glucose import	Any process that stops, prevents, or reduces the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle.
negative regulation of insulin receptor signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of insulin receptor signaling.
negative regulation of protein localization to plasma membrane	Any process that stops, prevents or reduces the frequency, rate or extent of protein localization to plasma membrane.
negative regulation of protein phosphorylation	Any process that stops, prevents or reduces the rate of addition of phosphate groups to amino acids within a protein.
positive regulation of ATP biosynthetic process	Any process that activates or increases the frequency, rate or extent of ATP biosynthetic process.
positive regulation of fat cell proliferation	Any process that activates or increases the rate or extent of fat cell proliferation.
positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product (protein or RNA).
positive regulation of reactive oxygen species metabolic process	Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
positive regulation of transcription by RNA polymerase II	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
regulation of mitochondrial fusion	Any process that modulates the frequency, rate or extent of merging of two or more mitochondria within a cell to form a single compartment.
regulation of mitochondrial membrane potential	Any process that modulates the establishment or extent of the mitochondrial membrane potential, the electric potential existing across the mitochondrial membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
regulation of reactive oxygen species metabolic process	Any process that modulates the frequency, rate or extent of reactive oxygen species metabolic process.

1 homologous proteins in AiPD

UniProt AC	Gene Name	Protein Name	Species	Evidence Code
Q3UBG2	Pid1	PTB-containing, cubilin and LRP1-interacting protein	Mus musculus (Mouse)	PR

10	20	30	40	50	60
MFSLPLSLPL	CEDTAFLPSK	CCSSHKTIKQ	ARTLIMIFLA	SGTHFQTMLK	SKLNVLTLKK
70	80	90	100	110	120
EPLPAVIFHE	PEAIELCTTT	PLMKTRTHSG	CKVTYLGKVS	TTGMQFLSGC	TEKPVIELWK
130	140	150	160	170	180
KHTLAREDVF	PANALLEIRP	FQVWLHHLDH	KGEATVHMDT	FQVARIAYCT	ADHNVSPNIF
190	200	210	220	230	240
AWVYREINDD	LSYQMDCHAV	ECESKLEAKK	LAHAMMEAFR	KTFHSMKSDG	RIHSNSSSEE

VSQELESDDG